Recombinant Human IL17D Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TAD2

Gene Name: IL17D

Expression System: Escherichia coli

Molecular Weight: 62.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 40%

Start Site: Ala21

End Site: Ala200

Coverage: 0.98

Isoelectric Point: 6.5

Core Sequence: AGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 40%, Rat - 41%, Pig - 83%, Cynomolgus monkey - 42%

Alternative gene names: /

Alternative protein names: Interleukin-17D; IL-17D; Interleukin-27; IL-27

Protein name: interleukin 17D

Full length: 202 amino acids

Entry name: IL17D_HUMAN

Product panel: Cytokines

• SKU: ASBPP-3701-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3701-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 53342