Recombinant Human IL9R Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q01113

Gene Name: IL9R

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Gln131

End Site: Pro270

Coverage: 0.30

Isoelectric Point: 5

Core Sequence: QVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Pig - 72%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Interleukin-9 receptor; IL-9 receptor; IL-9R; CD antigen CD129

Protein name: interleukin 9 receptor

Full length: 521 amino acids

Entry name: IL9R_HUMAN

CD Antigen: CD129

Product panel: CD Antigen

• SKU: ASBPP-3716-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3716-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3581