Recombinant Human IL9R Protein

Recombinant Human IL9R Protein
SKU
ASBPP-3716-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q01113

Gene Name: IL9R

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Gln131

End Site: Pro270

Coverage: 0.30

Isoelectric Point: 5

Core Sequence: QVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Pig - 72%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Interleukin-9 receptor; IL-9 receptor; IL-9R; CD antigen CD129

Protein name: interleukin 9 receptor

Full length: 521 amino acids

Entry name: IL9R_HUMAN

CD Antigen: CD129

Product panel: CD Antigen
More Information
SKU ASBPP-3716-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3716-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3581
Product information (PDF)
×
MSDS (PDF)
×