Recombinant Human INHBC Protein

Recombinant Human INHBC Protein
SKU
ASBPP-3742-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P55103

Gene Name: INHBC

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Gly237

End Site: Ser352

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 91%, Pig - 95%

Alternative gene names: /

Alternative protein names: Inhibin beta C chain; Activin beta-C chain

Protein name: inhibin subunit beta C

Full length: 352 amino acids

Entry name: INHBC_HUMAN

Product panel: Cytokines,Autoimmune Disease
More Information
SKU ASBPP-3742-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3742-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3626
Product information (PDF)
×
MSDS (PDF)
×