Recombinant Human INPPL1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O15357

Gene Name: INPPL1

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Glu861

End Site: Ala950

Coverage: 0.07

Isoelectric Point: 10

Core Sequence: EETGNIRGSMKVRVPTERLGTRERLYEWISIDKDEAGAKSKAPSVSRGSQEPRSGSRKPAFTEASCPLSRLFEEPEKPPPTGRPPAPPRA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: SHIP2

Alternative protein names: Phosphatidylinositol 3; 4; 5-trisphosphate 5-phosphatase 2; Inositol polyphosphate phosphatase-like protein 1; INPPL-1; Protein 51C; SH2 domain-containing inositol 5'-phosphatase 2; SH2 domain-containing inositol phosphatase 2; SHIP-2

Protein name: inositol polyphosphate phosphatase like 1

Full length: 1258 amino acids

Entry name: SHIP2_HUMAN

Product panel: Enzyme

• SKU: ASBPP-1049-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-1049-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 3636