Recombinant Human IRF5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q13568

Gene Name: IRF5

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Thr71

End Site: Gln170

Coverage: 0.21

Isoelectric Point: 4.5

Core Sequence: TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 38%, Pig - 82%, Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: Interferon regulatory factor 5; IRF-5

Protein name: interferon regulatory factor 5

Full length: 498 amino acids

Entry name: IRF5_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-437-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-437-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3663