Recombinant Human IYD Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6PHW0

Gene Name: IYD

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Lys31

End Site: His210

Coverage: 0.66

Isoelectric Point: 6.5

Core Sequence: KGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 82%, Pig - 86%, Cynomolgus monkey - 96%

Alternative gene names: C6orf71; DEHAL1

Alternative protein names: Iodotyrosine deiodinase 1; IYD-1; Iodotyrosine dehalogenase 1

Protein name: iodotyrosine deiodinase

Full length: 289 amino acids

Entry name: IYD1_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4281-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4281-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 389434