Recombinant Human JDP2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8WYK2

Gene Name: JDP2

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Val11

End Site: Leu160

Coverage: 0.99

Isoelectric Point: 9

Core Sequence: VTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Jun dimerization protein 2

Protein name: Jun dimerization protein 2

Full length: 163 amino acids

Entry name: JDP2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3077-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3077-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 122953