Recombinant Human JDP2 Protein

Recombinant Human JDP2 Protein
SKU
ASBPP-3077-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8WYK2

Gene Name: JDP2

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Val11

End Site: Leu160

Coverage: 0.99

Isoelectric Point: 9

Core Sequence: VTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Jun dimerization protein 2

Protein name: Jun dimerization protein 2

Full length: 163 amino acids

Entry name: JDP2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3077-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3077-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 122953
Product information (PDF)
×
MSDS (PDF)
×