Recombinant Human JPH1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HDC5

Gene Name: JPH1

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Lys351

End Site: Val510

Coverage: 0.24

Isoelectric Point: 10

Core Sequence: KTREKVDRAIEGAQRAAAMARTKVEIANSRTAHARAKADAADQAALAARQECDIARAVARELSPDFYQPGPDYVKQRFQEGVDAKENPEEKVPEKPPTPKESPHFYRKGTTPPRSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKRSVADEQVTAIV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 52%, Pig - 88%, Cynomolgus monkey - 99%

Alternative gene names: JP1

Alternative protein names: Junctophilin-1; JP-1; Junctophilin type 1

Protein name: junctophilin 1

Full length: 661 amino acids

Entry name: JPH1_HUMAN

• SKU: ASBPP-4256-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4256-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 56704