Recombinant Human KANSL3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9P2N6

Gene Name: KANSL3

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Glu421

End Site: Gly510

Coverage: 0.10

Isoelectric Point: 6.5

Core Sequence: EKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQDEIVDFLTGVLTRAEGHMGSEPRDQDAEKKKKPRDVARRDLAFEVPERG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 98%, Pig - 97%

Alternative gene names: KIAA1310; NSL3; PRTD; SI1

Alternative protein names: KAT8 regulatory NSL complex subunit 3; NSL complex protein NSL3; Non-specific lethal 3 homolog; Serum inhibited-related protein; Testis development protein PRTD

Protein name: KAT8 regulatory NSL complex subunit 3

Full length: 904 amino acids

Entry name: KANL3_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3745-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3745-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55683