Recombinant Human KAT8 Protein

Recombinant Human KAT8 Protein
SKU
ASBPP-3078-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H7Z6

Gene Name: KAT8

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Ala11

End Site: Asp160

Coverage: 0.36

Isoelectric Point: 5.5

Core Sequence: AAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 95%, Pig - 99%, Cynomolgus monkey - 98%

Alternative gene names: MOF; MYST1

Alternative protein names: Histone acetyltransferase KAT8; Lysine acetyltransferase 8; MOZ; YBF2/SAS3; SAS2 and TIP60 protein 1; MYST-1; hMOF

Protein name: lysine acetyltransferase 8

Full length: 458 amino acids

Entry name: KAT8_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-3078-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3078-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 84148
Product information (PDF)
×
MSDS (PDF)
×