Note: Dry Ice fees will be extra-charged
Uniprot: Q9H7Z6
Gene Name: KAT8
Expression System: Escherichia coli
Molecular Weight: 19.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 96%
Start Site: Ala11
End Site: Asp160
Coverage: 0.36
Isoelectric Point: 5.5
Core Sequence: AAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMD
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 95%, Pig - 99%, Cynomolgus monkey - 98%
Alternative gene names: MOF; MYST1
Alternative protein names: Histone acetyltransferase KAT8; Lysine acetyltransferase 8; MOZ; YBF2/SAS3; SAS2 and TIP60 protein 1; MYST-1; hMOF
Protein name: lysine acetyltransferase 8
Full length: 458 amino acids
Entry name: KAT8_HUMAN
Product panel: DNA binding & Chromatin,Enzyme
English
Deutsch
