Recombinant Human KCNJ15 Protein

Recombinant Human KCNJ15 Protein
SKU
ASBPP-3086-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q99712

Gene Name: KCNJ15

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Asn231

End Site: Gln360

Coverage: 0.38

Isoelectric Point: 5.5

Core Sequence: NQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: KCNJ14

Alternative protein names: ATP-sensitive inward rectifier potassium channel 15; Inward rectifier K(+) channel Kir1.3; Inward rectifier K(+) channel Kir4.2; Potassium channel; inwardly rectifying subfamily J member 15

Protein name: potassium inwardly rectifying channel subfamily J member 15

Full length: 375 amino acids

Entry name: KCJ15_HUMAN
More Information
SKU ASBPP-3086-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3086-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3772
Product information (PDF)
×
MSDS (PDF)
×