Recombinant Human KCNJ9 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q92806

Gene Name: KCNJ9

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Ser261

End Site: Gln380

Coverage: 0.31

Isoelectric Point: 4.5

Core Sequence: SRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGGEAGADKEQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 67%

Alternative gene names: GIRK3

Alternative protein names: G protein-activated inward rectifier potassium channel 3; GIRK-3; Inward rectifier K(+) channel Kir3.3; Potassium channel; inwardly rectifying subfamily J member 9

Protein name: potassium inwardly rectifying channel subfamily J member 9

Full length: 393 amino acids

Entry name: KCNJ9_HUMAN

• SKU: ASBPP-4178-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4178-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 3765