Recombinant Human KCNQ2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O43526

Gene Name: KCNQ2

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Asp441

End Site: Asp520

Coverage: 0.11

Isoelectric Point: 10.5

Core Sequence: DRVFSSPRGVAAKGKGSPQAQTVRRSPSADQSLEDSPSKVPKSWSFGDRSRARQAFRIKGAASRQNSEEASLPGEDIVDD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 96%, Pig - 92%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Potassium voltage-gated channel subfamily KQT member 2; KQT-like 2; Neuroblastoma-specific potassium channel subunit alpha KvLQT2; Voltage-gated potassium channel subunit Kv7.2

Protein name: potassium voltage-gated channel subfamily Q member 2

Full length: 872 amino acids

Entry name: KCNQ2_HUMAN

• SKU: ASBPP-4326-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4326-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3785