Recombinant Human KCNQ3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O43525

Gene Name: KCNQ3

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Lys581

End Site: Leu680

Coverage: 0.12

Isoelectric Point: 9

Core Sequence: KHKKSQKGSAFTFPSQQSPRNEPYVARPSTSEIEDQSMMGKFVKVERQVQDMGKKLDFLVDMHMQHMERLQVQVTEYYPTKGTSSPAEAEKKEDNRYSDL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 85%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Potassium voltage-gated channel subfamily KQT member 3; KQT-like 3; Potassium channel subunit alpha KvLQT3; Voltage-gated potassium channel subunit Kv7.3

Protein name: potassium voltage-gated channel subfamily Q member 3

Full length: 872 amino acids

Entry name: KCNQ3_HUMAN

• SKU: ASBPP-4325-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4325-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 3786