Recombinant Human KLHL40 Protein

Recombinant Human KLHL40 Protein
SKU
ASBPP-4239-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q2TBA0

Gene Name: KLHL40

Expression System: Escherichia coli

Molecular Weight: 35.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Phe321

End Site: Lys620

Coverage: 0.49

Isoelectric Point: 5

Core Sequence: FMISEEGAVAYDPAANECYCASLSNQVPKNHVSLVTKENQVFVAGGLFYNEDNKEDPMSAYFLQFDHLDSEWLGMPPLPSPRCLFGLGEALNSIYVVGGREIKDGERCLDSVMCYDRLSFKWGESDPLPYVVYGHTVLSHMDLVYVIGGKGSDRKCLNKMCVYDPKKFEWKELAPMQTARSLFGATVHDGRIIVAAGVTDTGLTSSAEVYSITDNKWAPFEAFPQERSSLSLVSLVGTLYAIGGFATLETESGELVPTELNDIWRYNEEEKKWEGVLREIAYAAGATFLPVRLNVLCLTK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 54%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: KBTBD5; SRYP

Alternative protein names: Kelch-like protein 40; Kelch repeat and BTB domain-containing protein 5; Sarcosynapsin

Protein name: kelch like family member 40

Full length: 621 amino acids

Entry name: KLH40_HUMAN

Product panel: E3 Ligase
More Information
SKU ASBPP-4239-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4239-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 131377
Product information (PDF)
×
MSDS (PDF)
×