Recombinant Human KLHL41 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O60662

Gene Name: KLHL41

Expression System: Escherichia coli

Molecular Weight: 44.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Leu11

End Site: Gly380

Coverage: 0.63

Isoelectric Point: 4.5

Core Sequence: LRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQDIFALASRFQIPSVFTVCVSYLQKRLAPGNCLAILRLGLLLDCPRLAISAREFVSDRFVQICKEEDFMQLSPQELISVISNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGMFVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVVGGLYVDEENKDQPLQSYFFQLDSIASEWVG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: KBTBD10; KRP1

Alternative protein names: Kelch-like protein 41; Kel-like protein 23; Kelch repeat and BTB domain-containing protein 10; Kelch-related protein 1; Sarcosin

Protein name: kelch like family member 41

Full length: 606 amino acids

Entry name: KLH41_HUMAN

Product panel: E3 Ligase

• SKU: ASBPP-4245-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4245-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 10324