Recombinant Human KRAS Protein

Recombinant Human KRAS Protein
SKU
ASBPP-4351-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P01116

Gene Name: KRAS

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Cys186

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: KRAS2; RASK2

Alternative protein names: GTPase KRas; K-Ras 2; Ki-Ras; c-K-ras; c-Ki-ras) [Cleaved into: GTPase KRas; N-terminally processed]

Protein name: KRAS proto-oncogene, GTPase

Full length: 189 amino acids

Entry name: RASK_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4351-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4351-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3845
Product information (PDF)
×
MSDS (PDF)
×