Recombinant Human Cytokeratin-4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P19013

Gene Name: KRT4

Expression System: Escherichia coli

Molecular Weight: 41 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Gln131

End Site: Ile460

Coverage: 0.66

Isoelectric Point: 5

Core Sequence: QKVRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTSSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTKVQQLQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAHSKRVELEAALQQAKEELARMLREYQELMSVKLALDIEIATYRKLLEGEEYRMSGECQSAVSI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 84%, Pig - 90%, Cynomolgus monkey - 97%

Alternative gene names: CYK4

Alternative protein names: Keratin; type II cytoskeletal 4; Cytokeratin-4; CK-4; Keratin-4; K4; Type-II keratin Kb4

Protein name: keratin 4

Full length: 520 amino acids

Entry name: K2C4_HUMAN

• SKU: ASBPP-4147-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4147-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3851