Recombinant Human LAMC3 Protein

Recombinant Human LAMC3 Protein
SKU
ASBPP-3135-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6N6

Gene Name: LAMC3

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Gly1461

End Site: Leu1560

Coverage: 0.07

Isoelectric Point: 4.5

Core Sequence: GAGLSEMEQQIRESRISLEKDIETLSELLARLGSLDTHQAPAQALNETQWALERLRLQLGSPGSLQRKLSLLEQESQQQELQIQGFESDLAEIRADKQNL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Pig - 83%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Laminin subunit gamma-3; Laminin-12 subunit gamma; Laminin-14 subunit gamma; Laminin-15 subunit gamma

Protein name: laminin subunit gamma 3

Full length: 1575 amino acids

Entry name: LAMC3_HUMAN

Product panel: IHC Pathology
More Information
SKU ASBPP-3135-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3135-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10319
Product information (PDF)
×
MSDS (PDF)
×