Recombinant Human LCLAT1 Protein

Recombinant Human LCLAT1 Protein
SKU
ASBPP-3736-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6UWP7

Gene Name: LCLAT1

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: His181

End Site: Gln330

Coverage: 0.40

Isoelectric Point: 7

Core Sequence: HFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYVLHPRTTGFTFVVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDLQLWCHKRWEEKEERLRSFYQGEKNFYFTGQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 29%, Pig - 90%

Alternative gene names: AGPAT8; ALCAT1; LYCAT

Alternative protein names: Lysocardiolipin acyltransferase 1; 1-acylglycerol-3-phosphate O-acyltransferase 8; 1-AGP acyltransferase 8; 1-AGPAT 8; Acyl-CoA:lysocardiolipin acyltransferase 1

Protein name: lysocardiolipin acyltransferase 1

Full length: 414 amino acids

Entry name: LCLT1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3736-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3736-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 253558
Product information (PDF)
×
MSDS (PDF)
×