Recombinant Human LLPH Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BRT6

Gene Name: LLPH

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Arg11

End Site: His90

Coverage: 0.68

Isoelectric Point: 10.5

Core Sequence: RKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPKHCQEKMQCEVKDEKDDMKMETDIKRNKKTLLDQH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Pig - 87%, Cynomolgus monkey - 97%

Alternative gene names: C12orf31; cPERP-G

Alternative protein names: Protein LLP homolog; Protein LAPS18-like

Protein name: LLP homolog, long-term synaptic facilitation factor

Full length: 129 amino acids

Entry name: LLPH_HUMAN

• SKU: ASBPP-3071-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3071-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84298