Recombinant Human LMOD1 Protein

Recombinant Human LMOD1 Protein
SKU
ASBPP-4407-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P29536

Gene Name: LMOD1

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Val11

End Site: Glu180

Coverage: 0.30

Isoelectric Point: 7

Core Sequence: VSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 82%, Pig - 84%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Leiomodin-1; 64 kDa autoantigen 1D; 64 kDa autoantigen 1D3; 64 kDa autoantigen D1; Leiomodin; muscle form; Smooth muscle leiomodin; SM-Lmod; Thyroid-associated ophthalmopathy autoantigen

Protein name: leiomodin 1

Full length: 600 amino acids

Entry name: LMOD1_HUMAN
More Information
SKU ASBPP-4407-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4407-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 25802
Product information (PDF)
×
MSDS (PDF)
×