Recombinant Human LSAMP Protein

Recombinant Human LSAMP Protein
SKU
ASBPP-3072-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q13449

Gene Name: LSAMP

Expression System: Escherichia coli

Molecular Weight: 32 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ser31

End Site: Asn300

Coverage: 0.96

Isoelectric Point: 6

Core Sequence: SVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: IGLON3; LAMP

Alternative protein names: Limbic system-associated membrane protein; LSAMP; IgLON family member 3

Protein name: limbic system associated membrane protein

Full length: 338 amino acids

Entry name: LSAMP_HUMAN
More Information
SKU ASBPP-3072-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3072-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4045
Product information (PDF)
×
MSDS (PDF)
×