Recombinant Human LSM2 Protein

Recombinant Human LSM2 Protein
SKU
ASBPP-4046-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y333

Gene Name: LSM2

Expression System: Escherichia coli

Molecular Weight: 53 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Gln95

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: C6orf28; G7B

Alternative protein names: U6 snRNA-associated Sm-like protein LSm2; Protein G7b; Small nuclear ribonuclear protein D homolog; snRNP core Sm-like protein Sm-x5

Protein name: LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated

Full length: 95 amino acids

Entry name: LSM2_HUMAN
More Information
SKU ASBPP-4046-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4046-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57819
Product information (PDF)
×
MSDS (PDF)
×