Recombinant Human LSM6 Protein

Recombinant Human LSM6 Protein
SKU
ASBPP-3082-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P62312

Gene Name: LSM6

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Met80

Coverage: 1.00

Isoelectric Point: 10

Core Sequence: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: U6 snRNA-associated Sm-like protein LSm6

Protein name: LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated

Full length: 80 amino acids

Entry name: LSM6_HUMAN
More Information
SKU ASBPP-3082-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3082-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 11157
Product information (PDF)
×
MSDS (PDF)
×