Recombinant Human MAB21L2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y586

Gene Name: MAB21L2

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Val41

End Site: Arg240

Coverage: 0.58

Isoelectric Point: 7

Core Sequence: VLKEVEVQEPRFISSLSEIDARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGKQSSAESDAWVLQFGEAENR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Protein mab-21-like 2

Protein name: mab-21 like 2

Full length: 359 amino acids

Entry name: MB212_HUMAN

• SKU: ASBPP-4183-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4183-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 10586