Recombinant Human MBD1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UIS9

Gene Name: MBD1

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Val81

End Site: Gln160

Coverage: 0.15

Isoelectric Point: 10.5

Core Sequence: VASKKRKKPSRPAKTRKRQVGPQSGEVRKEAPRDETKADTDTAPASFPAPGCCENCGISFSGDGTQRQRLKTLCKDCRAQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Pig - 85%, Cynomolgus monkey - 99%

Alternative gene names: CXXC3; PCM1

Alternative protein names: Methyl-CpG-binding domain protein 1; CXXC-type zinc finger protein 3; Methyl-CpG-binding protein MBD1; Protein containing methyl-CpG-binding domain 1

Protein name: methyl-CpG binding domain protein 1

Full length: 605 amino acids

Entry name: MBD1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-423-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-423-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 4152