Recombinant Human MCEE Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96PE7

Gene Name: MCEE

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Val51

End Site: Leu170

Coverage: 0.94

Isoelectric Point: 8

Core Sequence: VAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%

Alternative gene names: /

Alternative protein names: Methylmalonyl-CoA epimerase; mitochondrial; DL-methylmalonyl-CoA racemase

Protein name: methylmalonyl-CoA epimerase

Full length: 176 amino acids

Entry name: MCEE_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3980-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3980-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 84693