Recombinant Human MCIDAS Protein

Recombinant Human MCIDAS Protein
SKU
ASBPP-3173-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: D6RGH6

Gene Name: MCIDAS

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Tyr181

End Site: Thr360

Coverage: 0.49

Isoelectric Point: 7

Core Sequence: YWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDKLMITQSRDCGAAAEPFLLKAKAKRSLEELVSAAGQDCAEVDAILREISERCDEALQSRDPKRPRLLPEPANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Rat - 80%, Pig - 93%, Cynomolgus monkey - 96%

Alternative gene names: IDAS; MCI; MCIN

Alternative protein names: Multicilin; Multiciliate differentiation and DNA synthesis-associated cell cycle protein; McIdas protein; Protein Idas

Protein name: multiciliate differentiation and DNA synthesis associated cell cycle protein

Full length: 385 amino acids

Entry name: MCIN_HUMAN
More Information
SKU ASBPP-3173-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3173-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 345643
Product information (PDF)
×
MSDS (PDF)
×