Recombinant Human MCMBP Protein

Recombinant Human MCMBP Protein
SKU
ASBPP-10456-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BTE3

Gene Name: MCMBP

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Asn91

End Site: Asn220

Coverage: 0.22

Isoelectric Point: 6.5

Core Sequence: NTKAHVLHFGKYRDVAECGPQQELDLNSPRNTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEASTGQQLNSLN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 92%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: C10orf119

Alternative protein names: Mini-chromosome maintenance complex-binding protein; MCM-BP; MCM-binding protein

Protein name: minichromosome maintenance complex binding protein

Full length: 642 amino acids

Entry name: MCMBP_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10456-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10456-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 79892
Product information (PDF)
×
MSDS (PDF)
×