Recombinant Human MCUB Protein

Recombinant Human MCUB Protein
SKU
ASBPP-3747-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NWR8

Gene Name: MCUB

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Arg81

End Site: Glu210

Coverage: 0.48

Isoelectric Point: 7

Core Sequence: RCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIFTADGNMISASTLMDILLMNDFKLVINKIAYDVQCPKREKPSNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Pig - 80%

Alternative gene names: CCDC109B

Alternative protein names: Calcium uniporter regulatory subunit MCUb; mitochondrial; MCUb; Coiled-coil domain-containing protein 109B

Protein name: mitochondrial calcium uniporter dominant negative subunit beta

Full length: 336 amino acids

Entry name: MCUB_HUMAN
More Information
SKU ASBPP-3747-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3747-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55013
Product information (PDF)
×
MSDS (PDF)
×