Recombinant Human METAP2 Protein

Recombinant Human METAP2 Protein
SKU
ASBPP-307-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P50579

Gene Name: METAP2

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Ala51

End Site: Gly190

Coverage: 0.31

Isoelectric Point: 7

Core Sequence: AGEQEPDKESGASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: MNPEP; P67EIF2

Alternative protein names: Methionine aminopeptidase 2; MAP 2; MetAP 2; Initiation factor 2-associated 67 kDa glycoprotein; p67; p67eIF2; Peptidase M

Protein name: methionyl aminopeptidase 2

Full length: 478 amino acids

Entry name: MAP2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-307-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-307-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10988
Product information (PDF)
×
MSDS (PDF)
×