Recombinant Human MIF4GD Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A9UHW6

Gene Name: MIF4GD

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Met1

End Site: Asp222

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: MGEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 94%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: SLIP1

Alternative protein names: MIF4G domain-containing protein; SLBP-interacting protein 1; hSLIP1

Protein name: MIF4G domain containing

Full length: 222 amino acids

Entry name: MI4GD_HUMAN

• SKU: ASBPP-4106-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4106-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 57409