Recombinant Human MIOX Protein

Recombinant Human MIOX Protein
SKU
ASBPP-4150-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UGB7

Gene Name: MIOX

Expression System: Escherichia coli

Molecular Weight: 34 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Met1

End Site: Trp285

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 90%, Cynomolgus monkey - 99%

Alternative gene names: ALDRL6; KSP32; RSOR

Alternative protein names: Inositol oxygenase; Aldehyde reductase-like 6; Kidney-specific protein 32; Myo-inositol oxygenase; MI oxygenase; Renal-specific oxidoreductase

Protein name: myo-inositol oxygenase

Full length: 285 amino acids

Entry name: MIOX_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4150-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4150-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55586
Product information (PDF)
×
MSDS (PDF)
×