Recombinant Human MMP9 Protein

Recombinant Human MMP9 Protein
SKU
ASBPP-3085-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P14780

Gene Name: MMP9

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Val101

End Site: Phe270

Coverage: 0.28

Isoelectric Point: 5.5

Core Sequence: VPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 89%, Cynomolgus monkey - 97%

Alternative gene names: CLG4B

Alternative protein names: Matrix metalloproteinase-9; MMP-9; 92 kDa gelatinase; 92 kDa type IV collagenase; Gelatinase B; GELB) [Cleaved into: 67 kDa matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9]

Protein name: matrix metallopeptidase 9

Full length: 707 amino acids

Entry name: MMP9_HUMAN

Product panel: Neuroscience Biomarkers,DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-3085-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3085-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4318
Product information (PDF)
×
MSDS (PDF)
×