Note: Dry Ice fees will be extra-charged
Uniprot: P14780
Gene Name: MMP9
Expression System: Escherichia coli
Molecular Weight: 21 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 84%
Start Site: Val101
End Site: Phe270
Coverage: 0.28
Isoelectric Point: 5.5
Core Sequence: VPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGF
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 89%, Cynomolgus monkey - 97%
Alternative gene names: CLG4B
Alternative protein names: Matrix metalloproteinase-9; MMP-9; 92 kDa gelatinase; 92 kDa type IV collagenase; Gelatinase B; GELB) [Cleaved into: 67 kDa matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9]
Protein name: matrix metallopeptidase 9
Full length: 707 amino acids
Entry name: MMP9_HUMAN
Product panel: Neuroscience Biomarkers,DNA binding & Chromatin,Enzyme
English
Deutsch
