Recombinant Human MMRN1 Protein

Recombinant Human MMRN1 Protein
SKU
ASBPP-422-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q13201

Gene Name: MMRN1

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Leu521

End Site: Glu770

Coverage: 0.20

Isoelectric Point: 5

Core Sequence: LSTEQVSDQKNAPAAESVSNNVTEYMSTLHENIKKQSLMMLQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCRNDFKFQLKDTEENLHVLNQTLAEVLFPMDNKMDKMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDME

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Pig - 77%, Cynomolgus monkey - 95%

Alternative gene names: ECM; EMILIN4; GPIA*; MMRN

Alternative protein names: Multimerin-1; EMILIN-4; Elastin microfibril interface located protein 4; Elastin microfibril interfacer 4; Endothelial cell multimerin) [Cleaved into: Platelet glycoprotein Ia*; 155 kDa platelet multimerin; p-155; p155]

Protein name: multimerin 1

Full length: 1228 amino acids

Entry name: MMRN1_HUMAN
More Information
SKU ASBPP-422-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-422-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 22915
Product information (PDF)
×
MSDS (PDF)
×