Recombinant Human MORF4L1 Protein

Recombinant Human MORF4L1 Protein
SKU
ASBPP-4041-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UBU8

Gene Name: MORF4L1

Expression System: Escherichia coli

Molecular Weight: 42.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Val362

Coverage: 1.00

Isoelectric Point: 9.5

Core Sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRSEKSLKTHEDIVALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 89%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: MRG15

Alternative protein names: Mortality factor 4-like protein 1; MORF-related gene 15 protein; Protein MSL3-1; Transcription factor-like protein MRG15

Protein name: mortality factor 4 like 1

Full length: 362 amino acids

Entry name: MO4L1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-4041-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4041-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10933
Product information (PDF)
×
MSDS (PDF)
×