Recombinant Human MSL3P1 Protein

Recombinant Human MSL3P1 Protein
SKU
ASBPP-3215-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P0C860

Gene Name: MSL3B

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Val11

End Site: Arg90

Coverage: 0.19

Isoelectric Point: 5.5

Core Sequence: VARALSRSRRYVCARDADASRRRRRPFNYGLSIEEKNENDENSLSSSSDSSEDKDEKISEECDIEEKTEVKEEPELQTKR

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 89%

Alternative gene names: MSL3L2

Alternative protein names: Putative male-specific lethal-3 protein-like 2; MSL3-like 2; Male-specific lethal-3 homolog 2; Male-specific lethal-3 homolog pseudogene 1

Protein name: MSL complex subunit 3B

Full length: 447 amino acids

Entry name: MS3L2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3215-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3215-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 151507
Product information (PDF)
×
MSDS (PDF)
×