Recombinant Human MSRA Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UJ68

Gene Name: MSRA

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Gly24

End Site: Lys235

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Rat - 88%, Pig - 87%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Mitochondrial peptide methionine sulfoxide reductase; Peptide-methionine; S)-S-oxide reductase; Peptide Met(O) reductase; Protein-methionine-S-oxide reductase; PMSR

Protein name: methionine sulfoxide reductase A

Full length: 235 amino acids

Entry name: MSRA_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3999-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3999-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 4482