Recombinant Human MST1R Protein

Recombinant Human MST1R Protein
SKU
ASBPP-388-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q04912

Gene Name: MST1R

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Val871

End Site: Pro950

Coverage: 0.06

Isoelectric Point: 6

Core Sequence: VPLKPEEHAIKFEYIGLGAVADCVGINVTVGGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Pig - 85%, Cynomolgus monkey - 94%

Alternative gene names: PTK8; RON

Alternative protein names: Macrophage-stimulating protein receptor; MSP receptor; CDw136; Protein-tyrosine kinase 8; p185-Ron; CD antigen CD136) [Cleaved into: Macrophage-stimulating protein receptor alpha chain; Macrophage-stimulating protein receptor beta chain]

Protein name: macrophage stimulating 1 receptor

Full length: 1400 amino acids

Entry name: RON_HUMAN

CD Antigen: CD136

Product panel: CD Antigen,Enzyme
More Information
SKU ASBPP-388-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-388-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4486
Product information (PDF)
×
MSDS (PDF)
×