Recombinant Human MYBPC1 Protein

Recombinant Human MYBPC1 Protein
SKU
ASBPP-4235-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q00872

Gene Name: MYBPC1

Expression System: Escherichia coli

Molecular Weight: 40 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Glu11

End Site: Pro340

Coverage: 0.29

Isoelectric Point: 7

Core Sequence: EVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 50%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: MYBPCS

Alternative protein names: Myosin-binding protein C; slow-type; Slow MyBP-C; C-protein; skeletal muscle slow isoform

Protein name: myosin binding protein C1

Full length: 1141 amino acids

Entry name: MYPC1_HUMAN
More Information
SKU ASBPP-4235-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4235-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 4604
Product information (PDF)
×
MSDS (PDF)
×