Recombinant Human MYF6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P23409

Gene Name: MYF6

Expression System: Escherichia coli

Molecular Weight: 28 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Met1

End Site: Lys242

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: BHLHC4; MRF4

Alternative protein names: Myogenic factor 6; Myf-6; Class C basic helix-loop-helix protein 4; bHLHc4; Muscle-specific regulatory factor 4

Protein name: myogenic factor 6

Full length: 242 amino acids

Entry name: MYF6_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-4262-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4262-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 4618