Recombinant Human MYL4 Protein

Recombinant Human MYL4 Protein
SKU
ASBPP-4060-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P12829

Gene Name: MYL4

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Met1

End Site: Gly197

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 96%, Cynomolgus monkey - 89%

Alternative gene names: MLC1

Alternative protein names: Myosin light chain 4; Myosin light chain 1; embryonic muscle/atrial isoform; Myosin light chain alkali GT-1 isoform

Protein name: myosin light chain 4

Full length: 197 amino acids

Entry name: MYL4_HUMAN
More Information
SKU ASBPP-4060-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4060-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 4635
Product information (PDF)
×
MSDS (PDF)
×