Recombinant Human MYLK2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H1R3

Gene Name: MYLK2

Expression System: Escherichia coli

Molecular Weight: 30 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Gly11

End Site: Ser280

Coverage: 0.47

Isoelectric Point: 6.5

Core Sequence: GIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASEKGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGSQDPGKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 60%, Pig - 70%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Myosin light chain kinase 2; skeletal/cardiac muscle; MLCK2

Protein name: myosin light chain kinase 2

Full length: 596 amino acids

Entry name: MYLK2_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4238-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4238-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 85366