Recombinant Human MYLK3 Protein

Recombinant Human MYLK3 Protein
SKU
ASBPP-4202-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q32MK0

Gene Name: MYLK3

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Leu141

End Site: Ser210

Coverage: 0.10

Isoelectric Point: 6.5

Core Sequence: LMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGTAERLPPIRAS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Rat - 57%, Pig - 65%, Cynomolgus monkey - 93%

Alternative gene names: MLCK

Alternative protein names: Myosin light chain kinase 3; Cardiac-MyBP-C-associated Ca/CaM kinase; Cardiac-MLCK

Protein name: myosin light chain kinase 3

Full length: 819 amino acids

Entry name: MYLK3_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4202-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4202-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 91807
Product information (PDF)
×
MSDS (PDF)
×