Note: Dry Ice fees will be extra-charged
Uniprot: P15173
Gene Name: MYOG
Expression System: Escherichia coli
Molecular Weight: 18.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 97%
Start Site: Tyr11
End Site: Asn140
Coverage: 0.66
Isoelectric Point: 8.5
Core Sequence: YQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLN
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 99%
Alternative gene names: BHLHC3; MYF4
Alternative protein names: Myogenin; Class C basic helix-loop-helix protein 3; bHLHc3; Myogenic factor 4; Myf-4
Protein name: myogenin
Full length: 224 amino acids
Entry name: MYOG_HUMAN
Product panel: IHC Pathology,DNA binding & Chromatin
English
Deutsch
