Recombinant Human MYOG Protein

Recombinant Human MYOG Protein
SKU
ASBPP-4260-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P15173

Gene Name: MYOG

Expression System: Escherichia coli

Molecular Weight: 60 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Tyr11

End Site: Asn140

Coverage: 0.66

Isoelectric Point: 6

Core Sequence: YQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: BHLHC3; MYF4

Alternative protein names: Myogenin; Class C basic helix-loop-helix protein 3; bHLHc3; Myogenic factor 4; Myf-4

Protein name: myogenin

Full length: 224 amino acids

Entry name: MYOG_HUMAN

Product panel: IHC Pathology,DNA binding & Chromatin
More Information
SKU ASBPP-4260-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4260-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 4656
Product information (PDF)
×
MSDS (PDF)
×